DPCstruct | MC2923
Metacluster Properties and Pfam Annotations
| Number of structural domains | 89 |
|---|---|
| Mean domain length (aa) | 82 ± 9 aa |
| Standard deviation of domain lengths | 9.22 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 23.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A662UVD9 | 4-74 | NKLIKEYKILEKRNVIGYSNKIRFKIVNGKVTDIPCIRIYVSKKVPITSLRQEDIIPSHLGDIHTDVVEIG |
| A0A3M1J350 | 2-86 | EKIRRVKARHQNQLLGLANVVGIGVGLKETGGLVTDQPAVIVNVSQKLPLSQLDPADVVPPLLDGVLTDVQATGQFSAFKPDDAT |
| A0A163WDF4 | 9-98 | None |
| M1YK41 | 4-87 | None |
| A0A840W4A6 | 1-75 | None |
| A0A1Q7D4D9 | 5-87 | None |
| A0A6D2I8R8 | 1-85 | None |
| A0A5R8Q8G3 | 76-175 | None |
| A0A5C7A6L6 | 4-84 | None |
| A0A1G2VLA5 | 36-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.