DPCstruct | MC29227
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 76 ± 4 aa |
| Standard deviation of domain lengths | 4.15 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 93.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 26.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0177 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N9PUP0 | 479-551 | DVEGANKLLDEAGITDTDGDGIREYNGQNLVFKAECPTGWSDWQAAINIAAAAGKSIGISIEAYFPDSPTWTE |
| A0A7V1DR69 | 612-692 | NLKDYEYDLDRARQLLEEGGYKDRDGDGWREDSRGNVLEFSLTTNAGNQVREKMCSILKEDWTKLGIKVNYRPLDFQTLVE |
| A0A7X3U4I8 | 530-608 | None |
| A0A3D0D9N4 | 815-883 | None |
| A0A842QBJ8 | 28-100 | None |
| A5UQ83 | 25-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.