DPCstruct | MC2922
Metacluster Properties and Pfam Annotations
| Number of structural domains | 116 |
|---|---|
| Mean domain length (aa) | 172 ± 35 aa |
| Standard deviation of domain lengths | 35.13 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 82.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 22.82 |
| Pfam Score | 50.69 |
| Assigned Pfam label(s) | PF00499- PF20501- PF03334- PF13244 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q9V8U2 | 219-379 | DWVLVALVVVGTLGAVLARTRIAAIVVLGVVGFTMTLWYFALGAADVAITQLLVEILTVCVMVLLLRRLPLRFQREKKRPRIVAAVV… |
| A0A3M1J2R5 | 6-170 | IFFALAAVAVLSALGVVFNKNVVHSALFLLLNFSTIAFLYFMLNAQFLGVAQILVYAGAIVVLFLFVVMLVGADVGEPLGNWLSGQN… |
| A0A7J0CZL1 | 14-186 | None |
| A0A7C3DY83 | 17-189 | None |
| A0A1R4FEJ2 | 27-205 | None |
| A0A6L9J3N4 | 4-171 | None |
| Q09EQ0 | 3-183 | None |
| A0A7V4PAI2 | 63-267 | None |
| A0A6A8G8J0 | 3-215 | None |
| A0A445D565 | 149-302 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.