DPCstruct | MC29219
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 156 ± 11 aa |
| Standard deviation of domain lengths | 11.32 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 22.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0303 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T0D0T9 | 186-324 | VESFYANKDIKERINQRASDFKKSVSIKLDRLYNKLKKQEIELKESDNAEFYKVKGELITSYIYIIEKGMSSVDVQNFYDPELSNIK… |
| F7JVR5 | 1-167 | MLETYYATKNQITRIRQKSADLRHIVQTALERARKKYALQMRQLSDTEDRDKYKVYGELIHTYGYNLEPGAKVLEALNYYNNEMVKI… |
| J1P181 | 142-302 | None |
| A0A1W1CE89 | 94-255 | None |
| A0A2V8QIV1 | 181-341 | None |
| A0A7V9JW96 | 67-237 | None |
| A0A369QLT4 | 286-427 | None |
| A0A831JZ28 | 72-235 | None |
| A0A380EGS4 | 1-138 | None |
| A0A7C6LQX3 | 39-187 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.