DPCstruct | MC29217
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 334 ± 82 aa |
| Standard deviation of domain lengths | 82.49 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 78.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 24.73 |
| Pfam Score | 97.73 |
| Assigned Pfam label(s) | PF15865- PF00542 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I8VTM8 | 61-251 | KDINEAFASFSAWINEGVDELTFVKLLCEKLFACHHQEALQVLFKQSNSENFTNWKFYLILVQSIASTCNSETTAFMKKYLKSRVLH… |
| A0A1B6IKI7 | 67-377 | LQSQGLVQFTTHIYYKTNLIAGLSEQFEKQIWCQDETLRQNCAETVAGLLATLVNLGPHTSRHVCGPAQQLLETVVEKFVDRLFEDS… |
| A0A1X2G967 | 2-360 | None |
| A0A834Q2Q5 | 67-371 | None |
| A0A6P5W5Q7 | 42-372 | None |
| A0A7M7N5H7 | 24-426 | None |
| A0A182WL39 | 158-476 | None |
| M7BVS6 | 13-350 | None |
| A0A4W3J2L8 | 9-321 | None |
| A0A6P6DLK3 | 28-300 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.