DPCstruct | MC29205
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 204 ± 27 aa |
| Standard deviation of domain lengths | 27.41 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 26.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09766 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E3XQM4 | 9-204 | DAVLDRIRELVEADPVNEDPAALNVRGYALLARLKALNRQANAATKEHKLATAAARTTVNQTHLGLQNLLYEKRHLEREIEKCRQFA… |
| A0A183DW01 | 3-159 | SFGEALRSRFISLRRLNRLAQYRNRKIRDQVNQERAVVEERYLQLQNIKSEIEHLQKEIERCYDFRSADEHIALVPLEEFYANAPAN… |
| A0A0D6M621 | 679-822 | None |
| A0A1Y2E2U0 | 1-255 | None |
| B6K732 | 1-190 | None |
| A0A4P9X958 | 29-248 | None |
| A0A397JF27 | 57-291 | None |
| A0A2I2YRY0 | 43-256 | None |
| A0A4S8N0Z0 | 2-188 | None |
| A0A820SV16 | 2-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.