DPCstruct | MC29201
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 70 ± 3 aa |
| Standard deviation of domain lengths | 3.26 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 82.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 27.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0580 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X1UV93 | 1-70 | MRRDKPEKNKELEHIKSLILKYEVDKLVVGLPLNMTGKEGEQAKRVRNFVDELSSGIEIPPLKRKYPLRK |
| A0A517YL14 | 48-118 | RRSEPKDAEWLQQLVQSERIVGLVIGLPLHTSGTESQKSAEVRKFAAWLAPLVKVPIALFDERFTTSQANE |
| A0A7L5YVH6 | 9-84 | None |
| A0A3B8VE84 | 5-73 | None |
| A8V5N7 | 1-66 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.