DPCstruct | MC29200
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 198 ± 22 aa |
| Standard deviation of domain lengths | 22.24 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 30.86 |
| Pfam Score | 82.61 |
| Assigned Pfam label(s) | CL0123- CL0040 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4T0QI29 | 56-246 | MIAYSNLETYDYNLTDEANELIDKGSHEARVYHSLDFEVGSDAKEIIQKVGQVSAKVGQGRAFKLGWIKKVDNKFFKNATEIQDVTV… |
| A0A6P5XB89 | 1-189 | MDEGQKCAAEGSPEAQVFLAIPPEGSISKGELQAKKARPFSFKIGCSQAGKNKWVDMGKQVSRKVQHVEDKVKDLLIRIQNGEAIGK… |
| F4PXN0 | 461-640 | None |
| A0A818HB37 | 68-260 | None |
| A0A453PNF5 | 23-210 | None |
| A0A453PNK2 | 70-271 | None |
| A0A5B7D429 | 1-267 | None |
| A0A811LMT5 | 152-341 | None |
| A0A4Y7J054 | 560-738 | None |
| A0A2R6CSQ8 | 41-251 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.