DPCstruct | MC292
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 455 ± 73 aa |
| Standard deviation of domain lengths | 72.89 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 76.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 16.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10744 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P8ZLN2 | 19-495 | RQSRVNALLERLHAKHNALRPWQETSKVVQLSSLPSMTDRLESIARQNMLGSHLSPSGTECYITSDMFYVEVQLDAAGQLVDVKVAH… |
| A0A2K6USB7 | 8-415 | DRLESIARQNGLGSHLSASGTECYITSDMFYVEVQLDPAGQLCDVKVAHHGENPVSCPELVQQLREKNFDEFSKHLKGLVNLYNLPG… |
| A0A3Q0KNR3 | 8-571 | None |
| F0WIR8 | 250-783 | None |
| A0A369S705 | 64-540 | None |
| A0A1X2GQ03 | 92-546 | None |
| A0A2H2I8P3 | 30-419 | None |
| A0A556TJM3 | 2-354 | None |
| E5R2V9 | 158-562 | None |
| A0A1Y2EQE9 | 113-690 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.