DPCstruct | MC29199
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 132 ± 26 aa |
| Standard deviation of domain lengths | 25.65 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 79.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 33.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11221 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X0S8Y8 | 1-130 | MDRLTQLQDAIDAMARMFTNSIYYVHEKSSMAELNKDIPVSQPKIQADEPQVFKENMHELVSDLVKKAKEIDSLIEVLPGIQQTEEE… |
| A0A6P5X9Y3 | 1-120 | MDAISQLEEQVNSIAGLALNTFGTLRRDAPLVTLSPYYPEPPANPMEESANFANQPKLMSAALVKAAKQFDTLVAALPSSEGGEEAQ… |
| A0A369RUS1 | 1-165 | None |
| A0A2V0PPC0 | 4-148 | None |
| H0VSC8 | 1-90 | None |
| A0A5E4F1N8 | 1-132 | None |
| A0A3B4E5H6 | 153-269 | None |
| A0A1S3SHS6 | 59-191 | None |
| A0A5S6PFN9 | 1-125 | None |
| Q8W0T0 | 1-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.