DPCstruct | MC29198
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 273 ± 45 aa |
| Standard deviation of domain lengths | 44.57 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 26.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D3D7W9 | 10-266 | TGDVDNAVNNYNRVASSAPTYADSYDTRQARQQADNYANSYTDKINKGYTSKYKGTIDELANQYQKNKFDWTPENSSEYQQAKEKYT… |
| A0A1Q6JHW1 | 8-254 | YQESERLRRLAEEMARHDAEKPSQWTGGQYGQQRDDALSKLLNREKFSYDVNGDALYQQYRDKYVQQGKQAMQDTMGQAAALTGGYG… |
| U2UCQ7 | 137-464 | None |
| R5ILW0 | 63-313 | None |
| A0A358ARU4 | 72-330 | None |
| A0A7X9KYA6 | 3-197 | None |
| A0A845LU31 | 50-338 | None |
| U2REK0 | 89-353 | None |
| A0A1Q6S150 | 66-347 | None |
| A0A7G6E419 | 149-342 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.