DPCstruct | MC29194
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 289 ± 53 aa |
| Standard deviation of domain lengths | 52.86 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 81.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 36.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12545 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A844YIL0 | 358-626 | PEALEYWEGLDTVYKAPFYRSVLFLELRTASREANDPDSERQGSVGRGYTAIGTLYPGAEKEAAEGEGRWEGNFETFASRVLSNNGG… |
| A0A7Y8B8R0 | 27-241 | ARDVYFAELKAAGREYNAVGGVRQGSYVRGRAAIAALFPGKDVAGNPITYKGDITLFGGSGVHTNFGGSIQMLTPGGGQTFGIEGAA… |
| A0A7Y8HBW0 | 54-324 | None |
| A0A5B7QXE8 | 546-838 | None |
| A0A2Z5E7J4 | 195-468 | None |
| A0A1H4UFT6 | 744-1059 | None |
| A0A556UPV6 | 506-875 | None |
| A0A849UCH5 | 615-993 | None |
| A0A0R3MM10 | 8-218 | None |
| A0A2S6NAH3 | 621-944 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.