DPCstruct | MC29191
Metacluster Properties and Pfam Annotations
| Number of structural domains | 82 |
|---|---|
| Mean domain length (aa) | 399 ± 102 aa |
| Standard deviation of domain lengths | 101.82 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 78.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 24.03 |
| Pfam Score | 88.58 |
| Assigned Pfam label(s) | PF21666- CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T9Y3Y7 | 5-469 | QVQQPTYSTPFTEGDYGDGYNIKTVFEQKILKVLTEIKNKPNWNKKIKNTEIREKWIKELQPHFEEKTINYAIDETLYYSDIFTGSL… |
| A0A384K2F0 | 2-415 | MSLTNFLTDIPDWHIGSFNDKDIAIWHEMAMKNQLISEKAWEWCLAELRDKARLFRTTNRVPALDAGACVSKSDINVPQPLKRELCT… |
| W7N7C6 | 102-429 | None |
| A0A7M5VC04 | 133-496 | None |
| A0A6P8BKW3 | 38-351 | None |
| A0A6G1M4A1 | 7-408 | None |
| A0A421JQJ7 | 154-572 | None |
| A0A177VZN4 | 226-547 | None |
| A0A1S8VZV4 | 475-942 | None |
| A0A4Z0YM94 | 53-513 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.