DPCstruct | MC29187
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 142 ± 31 aa |
| Standard deviation of domain lengths | 30.81 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 74.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 42.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05699 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V9DX33 | 9-127 | PEWLEVAQRQNPDIQKEDLSSAMSTDSRNGMCWSLLGLYKHVDVLQWFRDEGESLYPSMALLARIHLGKISSSAFQERVFSTGGIIM… |
| A0A225WN37 | 24-154 | WRSSAPKRQDIAVKKNLHKHEKPKAALKGKLSYHHNGRGYWRLHEVIGNVDICQWFREQDVSSVPTSIAVLARIWLGRSSTTAFQER… |
| A0A080ZIT4 | 11-136 | None |
| A0A6A3UT97 | 1-128 | None |
| A0A1V9YVM1 | 6-98 | None |
| A0A2P4YU66 | 295-474 | None |
| W2LR70 | 145-299 | None |
| D0MSI6 | 527-673 | None |
| V9E3B4 | 23-179 | None |
| A0A225WQM2 | 8-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.