DPCstruct | MC29186
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 129 ± 20 aa |
| Standard deviation of domain lengths | 19.79 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 67.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 38.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A081AE41 | 5-110 | LNALELLDKQNQVIVACGKSRSGLPSSVTSTLLSVPYEPDQRVPLIRPDTLAIVCVRRQHIVDCKLIARGKTSADVFKDPVLEEKEA… |
| A0A225WIF2 | 7-145 | VGPLKYAPRPGQGSNVAAVSPMELLHRQYIPLATCRTRKNGIPDSVMANLSMPYHPEELVSLVKPSTLALVHVCRQHIVGFTTASRS… |
| W2PKX2 | 13-163 | None |
| A0A662WFQ8 | 19-127 | None |
| A0A6A3LT46 | 303-447 | None |
| A0A6A3RTG5 | 133-278 | None |
| A0A6A3Q6Z4 | 1-101 | None |
| W2J373 | 27-193 | None |
| A0A6A4B485 | 41-182 | None |
| A0A225W8T5 | 95-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.