DPCstruct | MC29185
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 179 ± 15 aa |
| Standard deviation of domain lengths | 15.48 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 76.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 39.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A3RXA6 | 12-197 | STRQNDQRLSKSDFLRQLQLDEFDYESTAGFSLPEYELLRQVRDEQVRADDTWAVCPLVTTIVFNLVAEGSTNCSLTLRRRSFATNT… |
| A0A225WHA8 | 1-203 | MRSQRDITDNLGLEPEHDSTSEFTAHEFALLKQLRSEQLASREIRWESCYFVASVLYNSAVRQLDNPSLDIRKHSYYAIARRLGPID… |
| A0A6G0QYM5 | 110-300 | None |
| W2PQI9 | 1-160 | None |
| A0A6A3V6Q4 | 321-492 | None |
| W3A2H4 | 410-583 | None |
| A0A662Y306 | 8-187 | None |
| A0A662XHY8 | 132-305 | None |
| A0A6G0M8M8 | 79-256 | None |
| A0A6A3HDX7 | 300-482 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.