DPCstruct | MC29184
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 154 ± 24 aa |
| Standard deviation of domain lengths | 23.56 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 68.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 27.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A225WCX3 | 2-157 | GAGHYHMKGDQLHPMAKLLARRVISVEAFRHELYKLRNGYMCKDDLKRPNEQMVRIPIILWPGETMPQYTQKFEQWLASRDLSLVSL… |
| G4YGR2 | 13-122 | AMELLTSRIMTLEEFLAEEDQVARTGEENYSRKPIPVLLKAGETVDEYELAFERRLKRRNVDLGLVRHGPMVERRFRMDFAESRAWE… |
| A0A2P4XKN7 | 39-152 | None |
| W2YNT5 | 73-247 | None |
| V9DUK3 | 66-236 | None |
| K3WRV0 | 30-196 | None |
| H3GHS7 | 1-109 | None |
| A0A225WDK0 | 1-161 | None |
| A0A225W9C6 | 331-472 | None |
| G5AHA5 | 27-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.