DPCstruct | MC29183
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 119 ± 34 aa |
| Standard deviation of domain lengths | 33.87 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 75.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 39.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4FNG8 | 1-66 | MADYAARSLQQVVPLCDRVRCTDWMELDQALRGSKGIYGRTVDFFPAPFRSSDRRVNMNKARDWWK |
| A0A484E9H3 | 24-165 | RLLQKVSTISKRVKVVGWTVNDANENGEIGVVFRTINQFPSEFRGKYNAKHAKCARWWKSRAEVGDQDKFNTKSISTVTGYGRRQTN… |
| A0A225UQR9 | 18-128 | None |
| W2GPU7 | 72-232 | None |
| A0A2R6X5T8 | 25-206 | None |
| A0A6A3TMJ6 | 3-79 | None |
| A0A6A3JPU7 | 1-109 | None |
| A0A6A3IPP5 | 3-135 | None |
| A0A225WBE5 | 3-83 | None |
| A0A225VX83 | 1-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.