DPCstruct | MC29182
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 97 ± 11 aa |
| Standard deviation of domain lengths | 11.40 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 74.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 46.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A225W2C8 | 6-98 | SWIPLFAPKAARQAVWAELVEELSHPVNSTSTSQVAEDTVSLLMAMGMEAHAYLSLTALADWTASEAGTELQQWKRKLKTAFGSKDV… |
| A0A6A3H811 | 96-193 | MRSTGGWLSKFEPKPMAQAKWPVLSPELTHPVSSADLPGLVYETSTLLRAMGFHCMGRPSRLEQKKWTLKAAGNEVMLWKTKLRTAF… |
| A0A225VKM3 | 133-239 | None |
| A0A225VN04 | 57-156 | None |
| A0A6A3PVN8 | 6-99 | None |
| A0A225WBL8 | 20-108 | None |
| A0A6A3H6P4 | 144-249 | None |
| G4ZYU4 | 52-178 | None |
| A0A6G0S0S9 | 1-81 | None |
| A0A6G0R8K9 | 1-81 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.