DPCstruct | MC29181
Metacluster Properties and Pfam Annotations
| Number of structural domains | 136 |
|---|---|
| Mean domain length (aa) | 293 ± 90 aa |
| Standard deviation of domain lengths | 90.49 |
| Length coefficient of variation | 0.31 |
| Mean AlphaFold2 pLDDT confidence score | 82.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 18.34 |
| Pfam Score | 77.78 |
| Assigned Pfam label(s) | CL0063- PF18634 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A329SUY3 | 82-436 | VGDVFKLLKLREHGYIALASRKMEVLDDYMKLVIRTNSGEETLLHTLTMGFGGERKLARQLVLAKKDPRTRELATALQNALLNTWLA… |
| A0A225VZ77 | 2-315 | VVKLTEQYGDKELASILAAAKEVPETRYVAVNLLRAQMEKWLTQKKDVGDVFRYLKLDEAKYDLLASPVLTRWMAFVDRSYQKSYDV… |
| A0A0P1AY24 | 6-400 | None |
| A0A0P1B095 | 37-354 | None |
| A0A0P1B5K4 | 50-348 | None |
| A0A080ZTS8 | 3-193 | None |
| A0A2P4YQF4 | 49-357 | None |
| A0A2P4YVF6 | 64-275 | None |
| D0N0W7 | 14-223 | None |
| W2PTM2 | 118-388 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.