DPCstruct | MC29180
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 155 ± 20 aa |
| Standard deviation of domain lengths | 19.88 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 24.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7T5E1X4 | 46-205 | MAWLTLLLLLLSLLLPIILALLPIILFGLLGGIIFWLLQHWSYKHRPTCDICGVLTTLYNRKAAKPYLNPAQQIEADLDSVFYSVAI… |
| A0A0P8A969 | 355-469 | HFVCQTCQADLLPVAKEQVEDGLTQPQTVAQQLGSTSFQGLNCPNCTPILSHFHLRGYRLVKNKFKECPNCQELTVTCSTEVLVHVN… |
| A0A1G0K2Y6 | 1-131 | None |
| A0A848LMF6 | 12-166 | None |
| A0A7L9BFE4 | 127-244 | None |
| A0A081BN61 | 78-243 | None |
| A0A540WVD6 | 3-150 | None |
| A0A7J5LG48 | 85-280 | None |
| A0A844MHD3 | 47-188 | None |
| A0A353X0Y1 | 104-242 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.