DPCstruct | MC2918
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 395 ± 51 aa |
| Standard deviation of domain lengths | 51.48 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.41 |
| Mean intra-cluster sequence similarity (%) | 13.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0499 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R9NFN5 | 2-385 | FWIYVIQTIIWYYLLVKVSKDILNPFAISATLWFLGAALSQLRLSELIARWGIQTHFVVHIFAYVVIVCGFLFSKRNNIRGNKSTCL… |
| A0A437GY37 | 18-443 | YDIVLLASAGLFAALTWYWLHQPSATIYHPVTFYLAFHGLIFVIRPILSRIFDYRFVYILYDFEPALWDRIMVIAGANLGLLAFVGV… |
| A6LLX4 | 7-382 | None |
| A0A5B8BEP3 | 78-543 | None |
| A0A1M7D9U8 | 1-309 | None |
| A0A846NTL5 | 44-484 | None |
| A0A7Z0Q0J6 | 2-378 | None |
| E4THD1 | 13-442 | None |
| A0A5A9E7R8 | 18-437 | None |
| A0A0B0ELU7 | 10-384 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.