DPCstruct | MC29179
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 140 ± 18 aa |
| Standard deviation of domain lengths | 18.36 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 72.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 35.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7T5E132 | 5-141 | PAAVTFALLINYSFELGGTNLVDLIYSWLNLYPGKWVITATVEAIYQGRYKVNSVSRILEFWSLKGYPVHHFDYDFADVVCKKLIEL… |
| A0A0D6AJU0 | 7-132 | YISQTIILIKYYGFELHGYNIKELIIKWTKIYPHYWIPLAVIEAIYQGRLKAISVEQILNIWLKKGVINLSFNYEFSRLINPEKSSS… |
| A0A1J5GRK1 | 3-155 | None |
| T2JXH5 | 8-130 | None |
| A0A251WC61 | 19-169 | None |
| A0A352AGV8 | 28-159 | None |
| U5DJL8 | 46-175 | None |
| K9TQ99 | 3-139 | None |
| A0A6H1TTM2 | 1-135 | None |
| A0A6P0JSH7 | 1-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.