DPCstruct | MC29174
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 110 ± 9 aa |
| Standard deviation of domain lengths | 9.28 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 43.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0279 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J5AFV9 | 11-108 | PLDLFLKIGLDERTAKNTIANNKVTANLTAVIHEAAVTDGCDRAVGNLLYTVATKFPANALVHRPTLLQYVVSLKIKTPAQLEAAFS… |
| A0A0E9T3J7 | 1-102 | MADSLTLFTSIGLSEQKAKETLKNESLSSMLKEAINLAQRVLDAKSVDKAIGTLLYSMTSRLKYPQHLAFLTEQIALCRIFTELQLS… |
| A0A1R3HRM5 | 11-108 | None |
| A0A7J7WE11 | 6-115 | None |
| A0A834JPV8 | 6-105 | None |
| A0A498I6D0 | 482-607 | None |
| A0A7J6EEK2 | 83-190 | None |
| A0A835PYN8 | 13-110 | None |
| Q7ZWG7 | 4-112 | None |
| A0A820G0K4 | 6-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.