DPCstruct | MC29173
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 84 ± 11 aa |
| Standard deviation of domain lengths | 11.48 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 69.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.76 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 39.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5S9M8K0 | 1-75 | MAKVRVYEYAKAIDVSSKDIIAALKDMNVEVNNHMATLEDDTVKKLDAIYKKAKQKKETANEKPAEQKKKQSSNK |
| A0A845VFY4 | 1-78 | MAKVRVYELAKEFGVESKAVMAKLQELGEFVRSASSTIEAPVVRKLTDAFQQGNGGGKSAPKPGAPRKAAPKPAPASA |
| A0A7R8NZA3 | 1-83 | None |
| A0A7W0XZ57 | 1-86 | None |
| W4TS44 | 1-112 | None |
| A0A372G7C4 | 1-80 | None |
| A0A1H4KAY7 | 2-72 | None |
| A0A100WNA0 | 3-72 | None |
| A0A433FP65 | 1-78 | None |
| A0A399TI37 | 1-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.