DPCstruct | MC29170
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 60 ± 6 aa |
| Standard deviation of domain lengths | 6.05 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 47.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G3D532 | 275-330 | GVGVGFKLEVNRDIALVNKSEDVLKVEYGVPAKWWIEKNKGMVQKEDKSWVLMDRE |
| A0A314L4Y6 | 48-104 | YHGKGRRFVLAKGRDIALVNKACDFLKDHYCVPPNWRQDENKGMIRDKDGRWIQPER |
| Q5NAI4 | 348-403 | None |
| U5DH79 | 120-179 | None |
| A0A822XUV9 | 126-183 | None |
| A0A4U5R2G5 | 155-215 | None |
| A0A4V3WP75 | 51-109 | None |
| A0A835GTL4 | 16-78 | None |
| A0A5P1ETP3 | 82-143 | None |
| A0A4D6LJT9 | 429-487 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.