DPCstruct | MC2917
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 50 ± 5 aa |
| Standard deviation of domain lengths | 5.19 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 54.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14205 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D4S9X3 | 4-44 | NVKMYWLCCPKCGGKTRTQIRPHTVLEDFPLFCPKCKYTCV |
| R9NCE6 | 2-50 | KLEWIRCPICSSKTRDRIRADTIMKNYPLYYPKCKQETLINVKELQVTV |
| A0A4U8QB18 | 66-122 | None |
| D3AM92 | 41-91 | None |
| A0A3E4MGP8 | 3-41 | None |
| G5GKN6 | 194-241 | None |
| A7VX77 | 1-46 | None |
| A0A6N7WG76 | 1-58 | None |
| A0A1Y3RJX2 | 27-75 | None |
| A0A3E4E4X6 | 4-58 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.