DPCstruct | MC29169
Metacluster Properties and Pfam Annotations
| Number of structural domains | 68 |
|---|---|
| Mean domain length (aa) | 125 ± 24 aa |
| Standard deviation of domain lengths | 24.37 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 25.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834DK45 | 133-251 | LQENEEGKRSVCGAPTIFYMLHCGTALYNNLLWSNWSVDALSRVVIIGNSFRGLEERLLTRILQENYAYVAKVLEGLEEHAFPQTPR… |
| A0A314KGY6 | 34-143 | ENSEMRQVRRPTMFYMPVPNYNLIGNFLGANWSLSCINQIFLLTNSFHHSLTSISQCSLYGETVERLERILPFTTEIDIKTRYKQIY… |
| A0A6P8HDX5 | 1-102 | None |
| Q7XM03 | 216-420 | None |
| A0A146H5B2 | 320-439 | None |
| A0A0N5D0Y3 | 154-314 | None |
| A0A066WIH8 | 70-194 | None |
| F4PR00 | 179-312 | None |
| A0A177V9Z4 | 324-462 | None |
| A0A814VUR9 | 130-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.