DPCstruct | MC29165
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 105 ± 13 aa |
| Standard deviation of domain lengths | 13.32 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 23.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B2UGY0 | 34-142 | YLRVTWGELCAAEFAHLCSGLDPDEPRLPDSLWVVSGYTEWVSGPEPLISLGWDWRLNGITGVLELASATVRSNLMLIGQDRIDLGC… |
| W7WE08 | 1-79 | MGQTVWGGRAGDSAAGISWDWIEVSEGIIAIADPMMMITNLRLLGSEGEVLTAHEVAPHLNGLVHRLPWQAEVSRALEQ |
| B7T9W4 | 5-115 | None |
| A0A839LED4 | 12-130 | None |
| A0A368HFF0 | 42-161 | None |
| A0A257CIG5 | 1-94 | None |
| A0A480AVA3 | 6-106 | None |
| D3UT96 | 38-156 | None |
| A0A840RYP6 | 43-157 | None |
| F3LPY4 | 12-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.