DPCstruct | MC29160
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 205 ± 50 aa |
| Standard deviation of domain lengths | 49.75 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 77.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 26.52 |
| Pfam Score | 96.31 |
| Assigned Pfam label(s) | CL0172- PF04161 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y3NU94 | 49-267 | IEFISKEKPSAYFSLLSKVSKEENFPKTTFGQYQYIMKLPEVAELEIESLLKLSLSLRSEAPLIQSHYHYYNASVIPSHKVNSNFDT… |
| A0A183J347 | 2-212 | SQEKPDLFWQFLDNVLEDPQALANSTDKDDYNLAMRAASSLLGSQTKLDLLKFSLALRAYSPAVEMQQQIATIEVGTFDCSYIVDVN… |
| A0A814E416 | 56-263 | None |
| E7F6G9 | 46-265 | None |
| A0A822D7I6 | 2-147 | None |
| A0A5B6Z7P7 | 9-317 | None |
| A0A6V7WZL2 | 66-260 | None |
| A0A7M3RUT0 | 4-281 | None |
| A0A5J5S222 | 9-315 | None |
| A0A2P4S8J1 | 9-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.