DPCstruct | MC2916
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 72 ± 5 aa |
| Standard deviation of domain lengths | 5.04 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 94.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 40.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16163 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R9NA21 | 1-73 | MNYVFSPDTYFKYNYEDEWFEDDFVKMMVQDVDGSTVVSAHSIDSPVLGIIAPERLSGGVKPLLLCIKSRILL |
| N2B4B0 | 58-126 | GYDTEAILSIDKYFNNTYDEDWLDDPFVKEMVLDVDCSEVLDKYCIQSPVLGQIPPEKLSGGVKALICM |
| A0A426DN66 | 1-78 | None |
| A5KN13 | 1-78 | None |
| A0A1H7Q046 | 7-74 | None |
| R7FFR5 | 19-85 | None |
| A0A856PYH9 | 1-80 | None |
| A0A7U9MRM2 | 19-84 | None |
| A0A1H4DZ13 | 116-184 | None |
| A0A7X5CUR9 | 18-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.