DPCstruct | MC29159
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 112 ± 5 aa |
| Standard deviation of domain lengths | 4.73 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 76.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 63.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12014 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A9A6T6 | 1-109 | MFIARMGEPSMEAFPWQTDGESRNVDVERSFAGEGIANGYGFRYPGSKPGSLFVLQGGLLAFVWRETGAVLTLQRLNLEELLKKGER… |
| A0A804JZH0 | 495-601 | MFIVKMDETTSEPFPWETDGESLQVEVKSSHSGEGIANGYGFRYPGSKPGSLFVLQNGLLAFVWKESQSILTLQRVDLQELLKKGER… |
| A0A072TH99 | 72-180 | None |
| A0A3L6PPE1 | 441-556 | None |
| M8B160 | 84-191 | None |
| A0A0R0JSY5 | 495-614 | None |
| A0A396GSK4 | 1-109 | None |
| A0A6J0M1X3 | 140-249 | None |
| A0A427B4P9 | 501-615 | None |
| A0A397ZJH2 | 342-461 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.