DPCstruct | MC29149
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 148 ± 27 aa |
| Standard deviation of domain lengths | 26.89 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 79.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 24.81 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0062 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q8RTA9 | 24-198 | WINPDIAPLPPNRRTWGVWAFLGFGSISNLCISAWTGAASLLSLGLTIPQTIGLMILARALICLLVIGNGWMGAEWHIGFTVSQRII… |
| W4UB68 | 7-144 | AQDEVRHGNTAPTASGAGRGVEKRTIDMVPDGERHGTPKSQFTLWFGVNMQITAVVNGALAIVFGADVVWAIIGLFIGQVIGGAVMA… |
| A0A4R2XJS2 | 1-97 | None |
| S3BUA0 | 10-162 | None |
| A0A3S4J8W5 | 1-135 | None |
| A0A2H1IX17 | 20-153 | None |
| A0A401GZ09 | 19-180 | None |
| A0A820RFN0 | 78-241 | None |
| A0A1Q5TF47 | 19-147 | None |
| A0A0D1ZEY0 | 28-232 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.