DPCstruct | MC29146
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 264 ± 18 aa |
| Standard deviation of domain lengths | 17.63 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 33.09 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0036- CL0099 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U9HPX9 | 212-487 | YTDVSYLACAKKLLGVPNLIYPQFATHNAHTLAAIYQLAGQNYYPGQYEFQCLHGMGEPLYEQVTGKVADGKLNRPCRIYAPVGTHE… |
| A0A376RKT6 | 21-277 | IYPQFATHNAHTLAAIYQLAGQNYYPGQYEFQCLHGMGEPLYEQVTGKVADGKLNRPCRIYAPVGTHETLLAYLVRRLLENGANTSF… |
| A0A539DV87 | 5-233 | None |
| A0A3F2UYD9 | 81-329 | None |
| A0A378CR19 | 353-628 | None |
| A0A6N9ETQ7 | 314-562 | None |
| A0A2A2HFY8 | 210-488 | None |
| A0A6J7M0W2 | 22-296 | None |
| A0A7X7GVL0 | 335-619 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.