DPCstruct | MC29145
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 73 ± 11 aa |
| Standard deviation of domain lengths | 11.18 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 91.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 40.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0748 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G1I9G1 | 65-137 | KHLQRKGFEFKELEAAGLSRQGRHGPMDRFHRRLLWPIRSSAGEVIGFGARRLFDDDPMEAKYVNTPETLLYK |
| W4U4F6 | 11-73 | IESGLVRSQGWDFFFQGRVLWPIKDSGKSVLGFGARRVYDDDRLPAKYVNTPETPVYKKNHMS |
| A0A416PFK1 | 185-245 | None |
| A0A357NJC3 | 11-77 | None |
| A0A1A9VKA8 | 115-179 | None |
| A0A7V8SY78 | 13-77 | None |
| A0A4S5CJY7 | 56-129 | None |
| A0A3A5IX16 | 6-64 | None |
| A0A7W1S7A2 | 12-80 | None |
| A0A7J9YNZ1 | 171-242 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.