DPCstruct | MC29144
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 77 ± 12 aa |
| Standard deviation of domain lengths | 12.35 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 91.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 58.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W4U4C7 | 5-105 | TDITRRVAPFHVVSEFQPSGDQPQAIAELEKRVNSGEQDVVLLGATGTGKTATVAWLAERLQRPMLVMQPNKTLAAQFAQELRTSSL… |
| A0A3S4LMB2 | 10-81 | FQLNQPFPPAGDQPAAIEQLVEGLSDGLSYQTLLGVTGSGKTYTMANVIARTGRPAIIMAHNKTLAAQLYSE |
| A0A3E0P1V4 | 215-316 | None |
| A0A142YN54 | 2-90 | None |
| A0A5C8EGG8 | 2-75 | None |
| A0A7T8XVD6 | 119-206 | None |
| A0A0G0NRW5 | 2-72 | None |
| A0A090MU98 | 179-266 | None |
| A0A554JHU3 | 4-74 | None |
| A0A061A9E4 | 2-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.