DPCstruct | MC29142
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 128 ± 8 aa |
| Standard deviation of domain lengths | 7.84 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 95.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 25.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C4TB49 | 10-138 | PKPTYQDARLLLEIAKQTQDTAFQKAREWFFASLPEEPITLEEFEQKFPKGSEGSSHLDFLSSHFETAGVLVKYKLLNEDLYFDRYF… |
| A0A7X1ZJC0 | 2-119 | AKPNYQDATLMLQIAQWWAALGQNEAMNWMWSDQFIADYAEFVKKYPPGSEGFANASKICGVFETIGTLYKHELFNEELLFDWLAIG… |
| A0A7C3P937 | 2-131 | None |
| A0A537IYX8 | 2-127 | None |
| A0A523DUA5 | 1-141 | None |
| A0A660UFM8 | 7-125 | None |
| A0A838PA19 | 3-130 | None |
| A0A2V7LPP4 | 2-119 | None |
| A0A2V7LG91 | 49-183 | None |
| A0A535HPY0 | 26-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.