DPCstruct | MC29141
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 531 ± 39 aa |
| Standard deviation of domain lengths | 39.44 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 24.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C4F8Y6 | 1-613 | MRKSHERIGKIYWCRNCNVPLLGNVCGICGKSGEKIVLHHGVEIRPGFEYTVERINGLIEKIYGVRDALKGKLVLLHKIAGIDRTEE… |
| A0A1I0NEZ1 | 2-526 | IYWCKKCNEPIFDIELHKCFCDGELRKISEGTICNPVFKQERKLLSKIVGCNLNEKKIWYFGASKYFYDGVMNRIPYREWYKGKKHL… |
| A0A843IU94 | 2-570 | None |
| A0A424YG34 | 123-597 | None |
| A0A7C4RFK2 | 1-508 | None |
| A0A3D4LRY9 | 53-578 | None |
| A0A5J4RMU0 | 3-518 | None |
| A0A1D2R5E8 | 2-514 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.