DPCstruct | MC2914
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 113 ± 12 aa |
| Standard deviation of domain lengths | 11.92 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 19.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14190 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N7XZ92 | 1-100 | MKVKFKKWNCITRVGWHCNENLGIELIDEEDGGVIAKATINPDIELLDNQVAIKDYTENAGMVEALLSAGVISRYIKSVPAGFMMVP… |
| R9ML36 | 6-111 | FLKLRTGKKLEVWPTYYAYNRTLAISLFEEGEPYGNLTCCLDDAPGRNCAYIDVNNMGIDIVDVLEEEGVGKRTGKKRQSGYVVYPE… |
| A0A1Y4WKM6 | 48-177 | None |
| A0A413LJ00 | 1-114 | None |
| A0A388TCA1 | 2-97 | None |
| A0A3E2N9A5 | 5-112 | None |
| A0A3G8GVH0 | 3-102 | None |
| K1UEJ1 | 2-103 | None |
| A0A3R6PWV0 | 4-123 | None |
| A0A849Y3L6 | 140-255 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.