DPCstruct | MC29139
Metacluster Properties and Pfam Annotations
| Number of structural domains | 532 |
|---|---|
| Mean domain length (aa) | 242 ± 48 aa |
| Standard deviation of domain lengths | 48.09 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 87.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 17.03 |
| Pfam Score | 79.19 |
| Assigned Pfam label(s) | CL0258- PF19302- PF03485- CL0257- CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C1Q4C8 | 23-261 | LLTGKVIFKDVWINYHIVDEKGHKMSKSLGNVIDPKDILDRFGAEPFRMWAAIEGNLVKTDFRCSFDRIDGAKKTITKLWNVARFIS… |
| A0A6D0J4Q7 | 1-178 | IKASTWLNHFDADSLRYYYTAKLSSRIDDIDLNLEDFVQRVNADIVNKVVNLASRNAGLIAKRFDGVLSAELADPELYKTFTDAAAA… |
| A0A7S3ZYJ7 | 11-334 | None |
| A0A1A9VK50 | 659-880 | None |
| A0A832B6G9 | 1-122 | None |
| A0A2J8ABT9 | 14-236 | None |
| A0A850KKR7 | 11-255 | None |
| A0A1B0C165 | 987-1251 | None |
| A0A1B0C1R2 | 363-633 | None |
| A0A6J7VLH3 | 3-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.