DPCstruct | MC29132
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 81 ± 14 aa |
| Standard deviation of domain lengths | 13.71 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 79.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 54.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7N2KW14 | 109-179 | VAFGGKRSEESEKIIEEIRNREWGLLLMDEVHVVPTHMFQKVIGISKSHCKLGLTATLVREDERITDLKFL |
| T0L9H2 | 1-70 | MLAYNGRRSQEAQKIMDTIQKTEWGLLLLDEVHVVPAQMFRKVVSLVTHHCKLGLTATLVREDDKIEDLN |
| A0A816SNP0 | 246-345 | None |
| A0A0K9RFE9 | 553-622 | None |
| A0A819JXA5 | 84-180 | None |
| A0A813P452 | 801-871 | None |
| A0A177WNC2 | 473-569 | None |
| A0A7J7LXJ6 | 193-272 | None |
| A0A816HG31 | 1-95 | None |
| A0A3R7YDJ9 | 24-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.