DPCstruct | MC29130
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 139 ± 18 aa |
| Standard deviation of domain lengths | 17.99 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.39 |
| Pfam Score | 84.29 |
| Assigned Pfam label(s) | PF05194- PF02814 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D7E422 | 3-129 | TLMQGKLFDFDVDIAVHLILELTAEERTRSRHRFTLPDGTVVFLRLPRGTVFHDGDVLTHESQCNFMKIVAKPESVLTVVADIPLLL… |
| A0A6D0EIW3 | 1-102 | MITLTQRLDHAHRVTTSVTLPIDIRVKSRARVTLNDGREAGLMLPRGLLLRGGDMLATEDGSEIIEVIAAPESVSVVRCADPFLLAR… |
| A0A3M5YCX8 | 19-156 | None |
| A0A2H5F1T9 | 3-120 | None |
| A0A1W6NXQ7 | 4-147 | None |
| A0A256G5W5 | 2-128 | None |
| A0A2D8QAZ4 | 28-179 | None |
| O06708 | 4-157 | None |
| A0A0P6W9L9 | 3-155 | None |
| A0A3L7ADJ7 | 3-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.