DPCstruct | MC2913
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 269 ± 22 aa |
| Standard deviation of domain lengths | 22.44 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 36.34 |
| Pfam Score | 84.85 |
| Assigned Pfam label(s) | CL0091- CL0159- CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A224Z0F2 | 31-277 | VNACGESSWPNGRPQPQVSARLYGPGLRGDFNLPARYFFVHVLDASGNNFTAASSTNLSVSITGTSSHCSIWTQVLNRRDGLFIVRY… |
| A0A6G1PG89 | 243-499 | QGISPERCLVWGPGLKPDAVLPVRYFFIQAVDSKGENMTVSPGKDTFKVKISSLDKKEHIRIHVSPPLDRGDGSFLVRYRLYSTSQQ… |
| A0A1X7UEN7 | 26-287 | None |
| A0A817ZHM3 | 8-220 | None |
| A0A2A9M6W6 | 28-339 | None |
| A0A0N1IDM4 | 1-258 | None |
| A0A3P8P1P7 | 7-267 | None |
| A0A7R9LFX0 | 1-257 | None |
| A0A3S3PK81 | 13-285 | None |
| A0A5C6PME9 | 22-300 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.