DPCstruct | MC29127
Metacluster Properties and Pfam Annotations
| Number of structural domains | 119 |
|---|---|
| Mean domain length (aa) | 94 ± 11 aa |
| Standard deviation of domain lengths | 10.51 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 26.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01817 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B6YX15 | 7-79 | KIKELRGEIDRIDEEIIKLLEKRLEVAREIGTLKAAAGLPIIDNEREREVLERAKKFRRIFEAIIAVSRDVQH |
| A0A369ULG7 | 23-127 | AMRYRHPSLGEFMSFEDEIIDMRSTIDDIDRQLIELLSQRFRCCMAVGELKKQFKVPVMQPSRVKEVVARAALAGSSHGMSPEFASR… |
| A0A7Y8LUJ9 | 13-94 | None |
| A0A4V6JGL1 | 5-97 | None |
| A0A5C7W3M8 | 7-105 | None |
| A0A368YXT6 | 32-141 | None |
| A0A849WTX1 | 15-99 | None |
| A0A7V0JV67 | 2-90 | None |
| A0A837Q4V0 | 5-100 | None |
| A0A1F3IS87 | 38-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.