DPCstruct | MC29125
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 185 ± 21 aa |
| Standard deviation of domain lengths | 20.52 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 27.06 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0229- CL0220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6M912 | 118-281 | QRYELLSLAERYNECAVCYFELYRLPVGILRSQSKRACSHYFHTECIKRLVAKNAHEARNAGHAAVRECPICRAKFSDIKTLPDVFK… |
| A0A813GJ79 | 43-234 | AGSGVAAVRQLRTTDSMANKRPFENQSAQNQQTQGSMDTRPAEPEPCPICLDCLGGQQLGVCVGADGHRSCSHYFHLACLRRVEGAC… |
| A0A812UMB1 | 1-174 | None |
| A0A1Q9EC65 | 1-184 | None |
| A0A812MUJ8 | 151-350 | None |
| A0A7S4RJF2 | 5-160 | None |
| A0A7S2RIH8 | 315-532 | None |
| A0A7S4A3V3 | 148-339 | None |
| A0A812XAX0 | 72-231 | None |
| A0A813DXU7 | 579-755 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.