DPCstruct | MC29123
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 138 ± 6 aa |
| Standard deviation of domain lengths | 5.97 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 86.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 56.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09418 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U9TER4 | 102-241 | HSILHRAQQKAGYWVGSSVIHLGDKNVPNALMFIDKYNQVSRILNPILICLESIEPVIAKNTGLRSYVDNSFGGVDALKKSILADFF… |
| A0A813GID5 | 1-115 | DRDVPNALVFIDKYTQVPRILNPLVNTLDRLPEVYNSTPAIKTLIDSEFNGLEVLRMTIMQDFFRHGFDGSGDDGGSCIDGRLTSCW… |
| A0A812RD47 | 332-472 | None |
| A0A3F2RS75 | 416-555 | None |
| A0A5B8MQT8 | 907-1042 | None |
| A0A2P4YPE5 | 1-143 | None |
| R7QJJ5 | 352-491 | None |
| A0A1J8QJG4 | 907-1046 | None |
| A0A7S0TIH1 | 129-269 | None |
| A0A7S3A7Y8 | 80-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.