DPCstruct | MC29121
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 307 ± 67 aa |
| Standard deviation of domain lengths | 66.82 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 74.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 32.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812KW40 | 250-463 | DEGFDEIRFAWNPQEVCKEYLHKWVLKNKILCRMEDIVPSDWFHLKSSEWQKVLADWHSKQGEFAAKQAYQEDEPPAEDGSSVTDVM… |
| A0A813G7S5 | 36-300 | RKWILQQKERLVVEGLTPGPWFASKIKAWKEARTSFRHAEFSARAKSDPTLLDLASSSDLSAVKDVHDADGSGMPVYAGFKYEDWLL… |
| A0A812YZ84 | 756-1085 | None |
| A0A812UW83 | 321-688 | None |
| A0A812T700 | 470-695 | None |
| A0A812I0P8 | 47-333 | None |
| A0A813E0C6 | 54-362 | None |
| A0A7J6UL64 | 82-433 | None |
| A0A7J6TUE7 | 4-385 | None |
| A0A7S4R7W9 | 428-915 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.