DPCstruct | MC29120
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 413 ± 19 aa |
| Standard deviation of domain lengths | 18.89 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 72.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.24 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 30.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6L8H2 | 1-422 | MMRLTILAVVAGAALAGQCTSNDHKFWSSYGSTFSNFLTGCAKKEWGNAEKTARCLVNDPESTLSGACGACFGDFEQCAKDQCWFHC… |
| A0A813G4Z0 | 1-436 | AFATCTGLYNSKSASLNISGLVGPPVSFTRQKADACTGEKDKAIWTSGGESRLNSASYKCGNQCAGENSCSAACISQSEGYSTDCSS… |
| A0A813HAD2 | 85-463 | None |
| A0A7J6S6X6 | 1-401 | None |
| A0A813H9N8 | 5-405 | None |
| A0A813FKE2 | 1-431 | None |
| C5LXZ5 | 184-607 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.