DPCstruct | MC29116
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 92 ± 9 aa |
| Standard deviation of domain lengths | 8.59 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 55.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0018 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7I1B3 | 57-135 | ILTEEEKRLCKKESILLPDFYPLTKAEERDLKRIRRKIRNKRSAQTSRKRKQDYIEQLEDRVADCSQENQELKAQVEML |
| A0A183S9P8 | 5-93 | FFQKGQRLVLSAEERRLLSRMGHKVPTMFPLSRSDERVIRAVRRKIRNKISAKASRARRQEYLQTLEMRIHRCHKENERLRSRVGEL… |
| A0A183WMQ2 | 7-77 | None |
| A0A6V7H436 | 1-83 | None |
| A0A7R9ABN0 | 897-986 | None |
| G0PP23 | 101-201 | None |
| A0A0K0EGG4 | 173-272 | None |
| S4RHP6 | 2-86 | None |
| A0A6P6CBQ7 | 150-232 | None |
| A0A6I9Q5N8 | 1-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.