DPCstruct | MC29115
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 118 ± 12 aa |
| Standard deviation of domain lengths | 11.95 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 35.77 |
| Pfam Score | 98.15 |
| Assigned Pfam label(s) | PF10228- CL0288 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y7M401 | 297-416 | AKTFYECGIVVPVDRKTKVGYREIPETNANIKKICKKIVESPNLSEQNKNSDALQELVTYVQYANDESDYGMGLELGLDLLAFGGEV… |
| A0A183S7A7 | 72-196 | NLHNGIGYRPVPLSNSELVNLLQKIVQSTDAKTKVPHQAKLDELVTLVQFANDEGDFGEGLELGLDLLAFHPKGENLQSASCFNSTI… |
| A0A673HN55 | 99-220 | None |
| H3H382 | 797-922 | None |
| S9YHU1 | 17-128 | None |
| A0A2P8YE00 | 317-426 | None |
| A0A151H2C2 | 377-504 | None |
| A0A0D8XPY4 | 3-133 | None |
| A0A2C6KUK8 | 500-629 | None |
| A0A7R9KC60 | 440-570 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.